Global Rank
Worldwidefamilylawselfhelpcenter.orgOctober 2023 Traffic Stats
Country Rank
United StatesReveal More Competitor Secrets for Free
- Which keywords they target
- Their most important pages
- Where their traffic comes from
- Where they get backlinks from
- How they monetize their site
familylawselfhelpcenter.org Web Traffic Statistics
Get a snapshot of familylawselfhelpcenter.org’s online performance by viewing its most critical traffic metrics
familylawselfhelpcenter.org Traffic and Visitor Engagement
Benchmark website’s performance against your competitors by keeping track of key indicators of onsite behavior. In October familylawselfhelpcenter.org received 150.42K visits with the average session duration 07:08. Compared to September traffic to familylawselfhelpcenter.org has increased by 450.15%.
familylawselfhelpcenter.org Website Traffic by Country
See the global distribution of visitors to your competitor’s website and start tapping into overlooked markets. Familylawselfhelpcenter.org's core audience is located in United States followed by Colombia, and India.
Country | All devices | Desktop | Mobile | |
---|---|---|---|---|
97.17% | 146.17K | 21.46% | 78.54% | |
Colombia | 0.69% | 1.04K | 100.0% | 0.0% |
0.59% | 892 | 100.0% | 0.0% | |
0.44% | 658 | 100.0% | 0.0% | |
Ukraine | 0.41% | 621 | 100.0% | 0.0% |
familylawselfhelpcenter.org Website Traffic Journey
Learn where visitors browse before landing on your competitor’s site and where they go after to find new opportunities for attracting your competition’s audience
familylawselfhelpcenter.org Competitors and Alternatives
Reveal other websites that your audience is interested in. See the list of domains users are browsing next. Familylawselfhelpcenter.org's audience also visits nvcourts.gov, followed by clarkcountycourts.us, and civillawselfhelpcenter.org.
familylawselfhelpcenter.org Organic and Paid Website Traffic
Discover how your top competitor’s audience surfs the web so you can tailor your website experience perfectly at every stage of the customer journey. Familylawselfhelpcenter.org’s traffic has increased by 20.57% month-on-month up to current organic search traffic. In addition, paid search traffic has dropped by -82.92% down to current paid search traffic.
familylawselfhelpcenter.org Top Organic Keyword
Organic Research is designed to help you discover competitors' best keywords. The tool will show you the top keywords driving traffic to familylawselfhelpcenter.org, while also providing the exact search volume, cost-per-click, search intent, and competition level for each keyword.
familylawselfhelpcenter.org Backlink Analytics
Analyze and track familylawselfhelpcenter.org’s backlink profile with the fastest backlink database available
Backlink Stats
Dive into your competitor’s SEO Authority Score and backlink profile. Fast check Authority Score your domain and Google Penalty risk. It is FREE with Backlink Analytics!
Backlinks and Referring Domains
Uncover the referring domains of your competition, assess their backlink profile expansion, and get a clear picture of the opportunities you may be missing. In October the number of backlinks to familylawselfhelpcenter.org has dropped by -0.16% and equals 170.68K. The amount of referring domains has dropped by -3.07% and equals 1.77K.